PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa017158
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family BBR-BPC
Protein Properties Length: 295aa    MW: 32402.1 Da    PI: 10.0298
Description BBR-BPC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-19437PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GAGA_bind305.22.3e-9312951301
  GAGA_bind   1 mdddgsrernkgyyepaaslkenlglqlmssia.erdaki....rernlalsekkaavaerd.........maflqrdkalaernkalverdnkllalll 86 
                mdddg + rn+gyyep+  +ke+lglqlms i   rd+k+    re+ + +++++ + ++r           ++ +rd +++          ++ll++l+
  Lsa017158   1 MDDDGLNMRNWGYYEPS--FKEHLGLQLMSPIVdHRDTKPflssRENPI-IMNPNMTPYHRSsipseppipLHY-MRDGWIQR---------ERLLHMLP 87 
                9*****99*******99..***********88868****9*99666555.777777777777799999998888.9*****99.........78999999 PP

  GAGA_bind  87 venslasalpvgvqvlsgtksidslqqlsepqledsave.lreeeklealpi.eeaaeeakekkkkkkr....qrakkpkekkakkkkkksekskkkvkk 180
                 +         + +++++t++ +s++++      ds+ e   + e l+a+p  +++  +     ++kkr      +++pk+++akk+kk       +  k
  Lsa017158  88 GNP--------SFSIIPDTSTSQSMHMMPPAPPPDSTKElGMNLEDLQAPPDgSDTGGDGGGGGSVKKRgagaTVSATPKQPRAKKPKK-----AASIPK 174
                544........477899999999999955533333333333334444444430333333333333332200002334455555555555.....445556 PP

  GAGA_bind 181 esaderskaekksidlvlngvslDestlPvPvCsCtGalrqCYkWGnGGWqSaCCtttiSvyPLPvstkrrgaRiagrKmSqgafkklLekLaaeGydls 280
                e+ ++rsk+ k+++d+v+ng+++D+s++P+PvCsCtG+++qCY+WG+GGWqSaCCtttiS+yPLP+stkrrgaRiagrKmSqgafkk+LekL +e y+++
  Lsa017158 175 ETGNQRSKSIKRNMDVVINGIDMDISGIPIPVCSCTGVPQQCYRWGAGGWQSACCTTTISMYPLPMSTKRRGARIAGRKMSQGAFKKVLEKLGSESYNFA 274
                6656899********************************************************************************************* PP

  GAGA_bind 281 npvDLkdhWAkHGtnkfvtir 301
                n++DL+ hWAkHGtnkfvtir
  Lsa017158 275 NAIDLRAHWAKHGTNKFVTIR 295
                ********************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM012261.3E-1451295IPR010409GAGA-binding transcriptional activator
PfamPF062171.8E-1021295IPR010409GAGA-binding transcriptional activator
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MDDDGLNMRN WGYYEPSFKE HLGLQLMSPI VDHRDTKPFL SSRENPIIMN PNMTPYHRSS  60
IPSEPPIPLH YMRDGWIQRE RLLHMLPGNP SFSIIPDTST SQSMHMMPPA PPPDSTKELG  120
MNLEDLQAPP DGSDTGGDGG GGGSVKKRGA GATVSATPKQ PRAKKPKKAA SIPKETGNQR  180
SKSIKRNMDV VINGIDMDIS GIPIPVCSCT GVPQQCYRWG AGGWQSACCT TTISMYPLPM  240
STKRRGARIA GRKMSQGAFK KVLEKLGSES YNFANAIDLR AHWAKHGTNK FVTIR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009608500.11e-123PREDICTED: protein BASIC PENTACYSTEINE2
RefseqXP_016489002.11e-123PREDICTED: protein BASIC PENTACYSTEINE2-like
SwissprotQ9SKD03e-91BPC1_ARATH; Protein BASIC PENTACYSTEINE1
TrEMBLA0A124SDN71e-154A0A124SDN7_CYNCS; GAGA binding-like protein
STRINGPGSC0003DMT4000757031e-117(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G14685.37e-89basic pentacysteine 2